RRC ID 6494
Author Ohyama T, Matsuda K, Tachibana H, Fujimoto Sakata S, Mori M, Horiuchi M, Tamaki N.
Title Purification and expression of a processing protease on beta-alanine-oxoglutarate aminotransferase from rat liver mitochondria.
Journal FEBS Lett
Abstract GABA[arrow beta]AlaAT convertase is an endopeptidase that processes brain-type 4-aminobutyrate aminotransferase (GABA AT; EC 2.6.1.19) to liver-type beta-alanine-oxoglutarate aminotransferase (beta-AlaAT I) in rats. Its molecular mass was 180 kDa as determined by gel filtration. A subunit molecular mass of 97652 Da was measured using MALDI-TOF MS. The N-terminal sequence of the purified GABA[arrow beta]AlaAT convertase was SRVEVSKVLILGSGGLSIGQAGEFDYSGSQAV- and was identical to residues 418-449 of carbamoyl-phosphate synthetase I (CPS I; EC 1.2.1.27) purified from rat liver. The subunit molecular mass and the N-terminal amino acid sequence suggested that GABA[arrow beta]AlaAT convertase was the 418-1305 peptide of CPS I. An expression vector containing the coding region of the 418-1305 peptide of rat CPS I was transfected into NIH3T3 cells and the extract of the cells showed GABA[arrow beta]AlaAT convertase activity.
Volume 572(1-3)
Pages 251-5
Published 2004-8-13
DOI 10.1016/j.febslet.2004.07.043
PII S0014579304009056
PMID 15304357
MeSH 3T3 Cells Alanine Transaminase / chemistry Alanine Transaminase / genetics Alanine Transaminase / metabolism* Amino Acid Sequence Animals Conserved Sequence Endopeptidases / metabolism* Humans Male Mice Mitochondria, Liver / enzymology* Molecular Sequence Data Rats Rats, Wistar Recombinant Proteins / metabolism Sequence Alignment Sequence Homology, Amino Acid Swine Transaminases / chemistry Transaminases / genetics Transaminases / metabolism* Transfection
IF 3.057
Times Cited 0
WOS Category BIOCHEMISTRY & MOLECULAR BIOLOGY BIOPHYSICS CELL BIOLOGY
Resource
Human and Animal Cells